PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400049274
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 509aa    MW: 55457.1 Da    PI: 8.0585
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400049274genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1079.3e-34216272259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           dDgynWrKYGqK+vkgse+prsYY+Ct ++Cpvkkkvers  d++v+ei+Y+g+Hnh+
  PGSC0003DMP400049274 216 DDGYNWRKYGQKQVKGSEYPRSYYKCTNPNCPVKKKVERSL-DGQVTEIIYKGQHNHQ 272
                           8****************************************.***************8 PP

2WRKY1079.2e-34394452159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+a+dpk+v++tYeg+Hnh+
  PGSC0003DMP400049274 394 LDDGYRWRKYGQKVVKGNPYPRSYYKCTSQGCNVRKHVERAASDPKAVITTYEGKHNHD 452
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.26210274IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.7E-30210274IPR003657WRKY domain
SuperFamilySSF1182902.88E-26213274IPR003657WRKY domain
SMARTSM007747.5E-38215273IPR003657WRKY domain
PfamPF031061.1E-25216272IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-37380454IPR003657WRKY domain
SuperFamilySSF1182905.75E-30386454IPR003657WRKY domain
PROSITE profilePS5081139.192389454IPR003657WRKY domain
SMARTSM007742.9E-40394453IPR003657WRKY domain
PfamPF031062.4E-26395452IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MAENEGSSSS STSRGQLLRP TITLPPRSSI ESLFSGGSSG ISPGPMTLVS SFFSDNDPDS  60
ECRSFSQLLA GAMTPPAGFT GGRPGFPPLP QPSTAAITQS PTTFTVPPGL SPTSLFDGFF  120
SPGQGPFGMS HQQVLAQLTS QASQVQSQMH IQPNYPSSAT AAAPSMSQFQ SLPSNAAANR  180
QIPPTLDPNI VKESSDVSLS DQRSEPASFA VDKPADDGYN WRKYGQKQVK GSEYPRSYYK  240
CTNPNCPVKK KVERSLDGQV TEIIYKGQHN HQPPQASKRS KECGNPNGNY NLQGPYELSS  300
EGLTGNFNKP KEGEPSYSLR MKDQESSQVN DQTSGSSDSE EVGNAETRVD GRDIDERESK  360
RRAVEVQSTE AACSHRTVAE PRIIVQTTSE VDLLDDGYRW RKYGQKVVKG NPYPRSYYKC  420
TSQGCNVRKH VERAASDPKA VITTYEGKHN HDVPAARNSS HNTANNSMSQ LRPHNPVVDK  480
PAAMRRADFQ RNEQQPIALL RFKEEQST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-42216455878Probable WRKY transcription factor 4
2lex_A2e-42216455878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111250.0AB711125.1 Solanum tuberosum StWRKY12 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239088.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-161WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLM1CR160.0M1CR16_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000728360.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41072445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-147WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]